PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00403.1.g00170.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family WRKY
Protein Properties Length: 704aa    MW: 75324.9 Da    PI: 7.9767
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00403.1.g00170.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY971.2e-30272329260
                                   --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                          WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                                   +Dgy+WrKYGqK+vk se+prsYY+Ct+++C+vkkkvers+ +++v+ei+Y+g Hnh+k
  Zpz_sc00403.1.g00170.1.sm.mk 272 EDGYSWRKYGQKQVKHSEYPRSYYKCTHPNCQVKKKVERSH-EGHVTEIVYKGMHNHPK 329
                                   8****************************************.***************85 PP

2WRKY105.52.7e-33479537159
                                   ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                          WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                   ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC+v+k+ver+++d + v++tYeg+Hnhe
  Zpz_sc00403.1.g00170.1.sm.mk 479 LDDGYRWRKYGQKVVKGNPNPRSYYKCTHPGCSVRKHVERASHDLQSVITTYEGKHNHE 537
                                   59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.7E-28263330IPR003657WRKY domain
SuperFamilySSF1182901.29E-25265330IPR003657WRKY domain
PROSITE profilePS5081122.699266330IPR003657WRKY domain
SMARTSM007743.6E-34271329IPR003657WRKY domain
PfamPF031061.5E-23272328IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.1E-37464539IPR003657WRKY domain
SuperFamilySSF1182904.32E-29471539IPR003657WRKY domain
PROSITE profilePS5081137.149474539IPR003657WRKY domain
SMARTSM007743.0E-38479538IPR003657WRKY domain
PfamPF031061.7E-25480537IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009555Biological Processpollen development
GO:0009846Biological Processpollen germination
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 704 aa     Download sequence    Send to blast
MDVLEKSEMS AIQFTTIPEE KLSRVVILVE HRAVAEMDGH VAKEEWKDQN PSREALMPSV  60
LTGAFPPDTT GRDGNEGANF GFEKHGFAAN SPQEGGRSLP MTPQFGQKTG SSSSFAERVH  120
ARTGFRVPKL NVPVSTATGA DNAVPGASSP YLTIPPGLSP ATLLESPVFI SNAMESSRNN  180
QHPSPRSTQV PIKSEANVQT VEATTTNLPD ELNLQHLNVG QPIQKSGSKQ SRPAPDPVTG  240
TEHLSPPDHS QQTEESDARG DLTSVATASP AEDGYSWRKY GQKQVKHSEY PRSYYKCTHP  300
NCQVKKKVER SHEGHVTEIV YKGMHNHPKP AQSRRPGVPA IHSFGDAQVN VSDSPGSQAK  360
NPWQNNAGVQ DSRSDGVDPT SSPSVPGELC DSSPSMQVRD GARFGSPGGV DVTSAVSDEV  420
DGDRVTHGSL SQGGAGAEGD KLESKRRKLE SYAIDMGCAS RAVREPRVVI QTTSEVDILD  480
DGYRWRKYGQ KVVKGNPNPR SYYKCTHPGC SVRKHVERAS HDLQSVITTY EGKHNHEVPA  540
ARNSGHPSSA APGAAMAAAG HHRAGARLPD HHHSSVQDTG LMRLGGCAFG GLPPRDPLVP  600
MANYPYATFG ASLPSLPMLP GPLGPVEGLK VPMLATSMHR PLLRHRQAME AAGLVAPKVV  660
EVKREAGAAG SPGGDGSGND NADAAATVYQ QLVQRRRMQL GHKM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-36272540878Probable WRKY transcription factor 4
2lex_A3e-36272540878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975929.10.0PREDICTED: probable WRKY transcription factor 34
RefseqXP_012702708.10.0PREDICTED: probable WRKY transcription factor 34
SwissprotQ9FG771e-109WRKY2_ARATH; Probable WRKY transcription factor 2
TrEMBLK3YEW80.0K3YEW8_SETIT; Uncharacterized protein
STRINGSi012785m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP207538100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.11e-109WRKY DNA-binding protein 2